PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.05G175700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family WOX
Protein Properties Length: 213aa    MW: 24375.5 Da    PI: 9.497
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.05G175700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.71.5e-2177136357
                          --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
             Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                          +R+++t+eq+ +Le l++   r+p+a+++e+++++l    +++ ++V++WFqN++a+e++
  Manes.05G175700.1.p  77 TRWNPTQEQIGILEMLYRGgMRTPNAQQIEQITAQLgrygKIEGKNVFYWFQNHKARERQ 136
                          7*****************99**************************************97 PP

2Wus_type_Homeobox118.13.8e-3877138465
    Wus_type_Homeobox   4 tRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                          tRW+Pt+eQi iLe+ly+ G+rtPn+++i++ita+L +yGkie+kNVfyWFQN+kaRerqkq
  Manes.05G175700.1.p  77 TRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGRYGKIEGKNVFYWFQNHKARERQKQ 138
                          8***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.20372137IPR001356Homeobox domain
SuperFamilySSF466899.41E-1372142IPR009057Homeodomain-like
SMARTSM003893.1E-774141IPR001356Homeobox domain
CDDcd000863.85E-577138No hitNo description
PfamPF000462.8E-1977136IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.3E-878136IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MGSMKVHQLS RGFWEHEPSL TLGCKRLRPL APKLANTDSI TSFDLKSFIR PESGPRKLGS  60
SDEKKDSPQV ETHAGGTRWN PTQEQIGILE MLYRGGMRTP NAQQIEQITA QLGRYGKIEG  120
KNVFYWFQNH KARERQKQKR NSLGRSHSPR TPGPITPISL DTREEVERDE DSPYKRKCRS  180
LAFECLELEE SRSCREEGDR TLELFPLHPE GR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006374903.11e-141homeobox-leucine zipper transcription factor family protein
SwissprotQ6X7J91e-75WOX4_ARATH; WUSCHEL-related homeobox 4
TrEMBLB9MVU11e-141B9MVU1_POPTR; Homeobox-leucine zipper transcription factor family protein
TrEMBLR9RIF31e-141R9RIF3_POPCA; WUSCHEL-related homeobox 4
STRINGPOPTR_0014s02540.11e-141(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61323452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G46480.13e-72WUSCHEL related homeobox 4